DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and rbfox1l

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_999940.1 Gene:rbfox1l / 407613 ZFINID:ZDB-GENE-040923-2 Length:382 Species:Danio rerio


Alignment Length:174 Identity:46/174 - (26%)
Similarity:78/174 - (44%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGSG 76
            |.::....|...:    |.|||.:::.           |..|..:..:.|:     :..:||.. 
Zfish    71 PLDFSAAHPNSEY----ADHHQLRVYQ-----------GPQHDGTESITAS-----NTDDSLAP- 114

  Fly    77 HTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILN 141
             .::...|.:|.|..|.|| |.||....||.:.|.  ::::.|:.....:..:...|..||.||:
Zfish   115 -VTSDPQSLSVSVASGSGA-AGGSDEEGGGKAQPK--RLHVSNIPFRFRDPDLRQMFGQFGKILD 175

  Fly   142 CNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHV 185
            ..:..:|.| |:|:|||.|:|...|..|.||:||.:...:|:.|
Zfish   176 VEIIFNERG-SKGFGFVTFESAVEADRAREKLNGTIVEGRKIEV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/69 (32%)
RRM3_I_PABPs 202..282 CDD:240826
rbfox1lNP_999940.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..79 1/7 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..148 17/63 (27%)
RRM <143..>237 CDD:223796 24/79 (30%)
RRM_FOX1_like 147..222 CDD:240853 23/75 (31%)
Fox-1_C 257..353 CDD:289199
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.