Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333123.1 | Gene: | rbm14b / 402858 | ZFINID: | ZDB-GENE-040426-2455 | Length: | 560 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 50/197 - (25%) |
---|---|---|---|
Similarity: | 89/197 - (45%) | Gaps: | 37/197 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 DSG---KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEK 172
Fly 173 VNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD 237
Fly 238 EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
Fly 303 QI 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 17/69 (25%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 22/79 (28%) | ||
rbm14b | XP_021333123.1 | RRM1_CoAA | 7..75 | CDD:241052 | 19/81 (23%) |
RRM1_2_CoAA_like | 84..149 | CDD:240789 | 23/83 (28%) | ||
AIR1 | <150..>187 | CDD:331526 | 4/16 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |