DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and rbm14b

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:197 Identity:50/197 - (25%)
Similarity:89/197 - (45%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DSG---KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEK 172
            |.|   |:::.||......:.:...|..:|.:::|:|.       |.:.|||...|.||..||.:
Zfish     2 DKGHTVKLFVGNLALDTTQEELSAIFESYGQVVSCSVL-------RQFAFVHLQGEGAAERAIRE 59

  Fly   173 VNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD 237
            :||.....:.:.|       :..:.:..|...::|.|||...|.:.|:|:|:.:|::.       
Zfish    60 LNGREFKGRNLVV-------EESRGRPLHSTKVFVGNLSSMCTTEDLQELFQTFGKVL------- 110

  Fly   238 EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
            |..:.:.:.||..||.:.||.|:..|||..       :..|.||     .|:: |::..|:...|
Zfish   111 ECDKVKGYAFVHMENKEDALQAIEALHGTS-------FKGRPLS-----VELS-KVQPSKQTPTG 162

  Fly   303 QI 304
            :|
Zfish   163 KI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/69 (25%)
RRM3_I_PABPs 202..282 CDD:240826 22/79 (28%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 19/81 (23%)
RRM1_2_CoAA_like 84..149 CDD:240789 23/83 (28%)
AIR1 <150..>187 CDD:331526 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.