DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and bru3

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001369050.1 Gene:bru3 / 39527 FlyBaseID:FBgn0264001 Length:552 Species:Drosophila melanogaster


Alignment Length:323 Identity:76/323 - (23%)
Similarity:119/323 - (36%) Gaps:71/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NPANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGS 75
            ||..::|..|     ..|.|..|||....||||   :..|...|..|.:||.|....||.|..|.
  Fly   141 NPFVFNQFSP-----YGAYAQQQQQAALMAAAA---TAPGSAAAYMNPMAALATQIPHGLNGTGQ 197

  Fly    76 GHTSTSSHSANVGVGV-------GGGALASGSTGGSGG---NSSPDSGKIYIKNLERSIDNKAVY 130
            ..:..|....|..:|.       ||.|.|:.:...:.|   |..|.:                  
  Fly   198 PPSLPSPTMPNFNMGANTPNGQPGGAAAAAAAAAAADGVFTNGIPQT------------------ 244

  Fly   131 DTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARA----------AIEKVNGMLCNNQKVHV 185
               :..|:.|:..:...        |..:.|:.....|          |...|.|.........:
  Fly   245 ---AFPGHPLHLTIPPQ--------GLPNGDAATLQHAFPGLPPFPGVAFPAVYGQFPQALPPPL 298

  Fly   186 VKFIPRRDREQEKATHFK----------NLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-E 239
            ....|   .::|....|.          ||::.:|.:||.:..|.:||.|:|.:.|.|:.:|. .
  Fly   299 AAVAP---TQREDFLMFPGCSISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRAT 360

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
            .:|:.||||:::||.||.||:..::|.|:|..:.....:....|.|.. .:..|:...:|..|
  Fly   361 NQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDASRPYXQSEFLKRNSQQPTG 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 8/79 (10%)
RRM3_I_PABPs 202..282 CDD:240826 28/90 (31%)
bru3NP_001369050.1 RRM2_CELF3_4_5_6 40..120 CDD:410043
ELAV_HUD_SF 43..404 CDD:273741 71/302 (24%)
RRM3_CELF3_4_5_6 319..397 CDD:241083 27/77 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.