DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and tia1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:170 Identity:48/170 - (28%)
Similarity:81/170 - (47%) Gaps:20/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            :|:.||.|.:....:...||..|...:|.:..|..||. .|.||.|.....|.|::..:||....
 Frog     9 LYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGND-PYCFVEFFEHRHAAASLAAMNGRKIM 72

  Fly   180 NQKVHV----VKFIPRRD----------REQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRIT 230
            .::|.|    .....::|          |.|:   || :::|.:||.|.|...::..|.|:|||:
 Frog    73 GKEVKVNWATTPSSQKKDANSSSVVSTLRSQD---HF-HVFVGDLSPEITTDDIKAAFAPFGRIS 133

  Fly   231 SHKLMLD-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            ..:::.| ..|:|:.:|||::.|...|..|:..:.|:.||
 Frog   134 DARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/69 (29%)
RRM3_I_PABPs 202..282 CDD:240826 23/69 (33%)
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027 21/72 (29%)
RRM2_TIA1 104..181 CDD:410030 24/74 (32%)
RRM3_TIAR 214..286 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.