DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and sf3b4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_989116.1 Gene:sf3b4 / 394721 XenbaseID:XB-GENE-492933 Length:388 Species:Xenopus tropicalis


Alignment Length:191 Identity:60/191 - (31%)
Similarity:86/191 - (45%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AAGHLS--------HVGG-----------------GHAASNHLAAAAVLGRHGHNSLGSGHTS-T 80
            |||.:|        :|||                 |...:.|:....|.|:|    .|.|... .
 Frog     2 AAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQH----QGYGFVEFL 62

  Fly    81 SSHSANVGVGVGGGALASGS----TGGSGGNSSPDSG-KIYIKNLERSIDNKAVYDTFSVFGNIL 140
            |...|:..:.:.......|.    ...|..|.:.|.| .|:|.||:..||.|.:|||||.||.||
 Frog    63 SEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVIL 127

  Fly   141 NC-NVAKDED-GNSRGYGFVHFDSEEAARAAIEKVNGM-LCNNQKVHVVKFIPRRDREQEK 198
            .. .:.:|.| |||:||.|::|.|.:|:.||||.:||. |||  :...|.:..::|.:.|:
 Frog   128 QTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCN--RPITVSYAFKKDSKGER 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 36/72 (50%)
RRM3_I_PABPs 202..282 CDD:240826
sf3b4NP_989116.1 RRM1_SF3B4 15..88 CDD:240780 13/76 (17%)
RRM2_SF3B4 99..181 CDD:240781 38/83 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.