DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and pabpc1b

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_957176.1 Gene:pabpc1b / 393856 ZFINID:ZDB-GENE-050308-1 Length:634 Species:Danio rerio


Alignment Length:191 Identity:97/191 - (50%)
Similarity:137/191 - (71%) Gaps:5/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.|:||||::||||||:|||||.|||||:|.|..||:| |:|||||||:::|||..||||:||||
Zfish    99 GNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGML 162

  Fly   178 CNNQKVHVVKFIPRRDREQE---KATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .|::||.|.:|..|::||.|   :|..|.|:|:||..|:..:..|:::|..||...|.::|.||.
Zfish   163 LNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDDKLKDIFSKYGNAMSIRVMTDEN 227

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            |:||.||||::|..:.|..||..::||:: :.|.:||.||..|.|||.|:.||.|:.|:.:
Zfish   228 GKSRGFGFVSFERHEDAQRAVDEMNGKEM-NGKLIYVGRAQKKVERQTELKRKFEQMKQDR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 48/69 (70%)
RRM3_I_PABPs 202..282 CDD:240826 32/79 (41%)
pabpc1bNP_957176.1 PABP-1234 11..613 CDD:130689 97/191 (51%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825 50/73 (68%)
RRM3_I_PABPs 190..269 CDD:240826 32/79 (41%)
RRM4_I_PABPs 293..370 CDD:240827
PABP 545..612 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.