DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and lark

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:159 Identity:42/159 - (26%)
Similarity:74/159 - (46%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PDSG--KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEK 172
            |.:|  |::|.||:.......:...|..:|.::.|:|.|:       |||||.::|:..|.||:.
  Fly     2 PGAGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKN-------YGFVHMETEQQGRDAIQN 59

  Fly   173 VNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD 237
            :||...|...:.|.....||    ...|....::|.||:::.....:||:|:.||.:....::  
  Fly    60 LNGYTLNEFAIKVEAAKSRR----APNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV-- 118

  Fly   238 EEGRSRRFGFVAYENPQSALAAVIGLHGK 266
                 |.:|||..:.......|:..|:|:
  Fly   119 -----RNYGFVHLDCVGDVQDAIKELNGR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/69 (29%)
RRM3_I_PABPs 202..282 CDD:240826 15/65 (23%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 21/71 (30%)
RRM1_2_CoAA_like 87..152 CDD:409779 15/63 (24%)
hnRNP-R-Q <88..>258 CDD:273732 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.