DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and shep

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster


Alignment Length:295 Identity:66/295 - (22%)
Similarity:111/295 - (37%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHN---------- 71
            |:.||:.....|||  ...|...|...|..|....|:|.:...|||||..:..:.          
  Fly    91 QRPPAMTSPAAAAA--GAALAAGAPYRGAASWTPQGYAPAAAAAAAAVAQQAAYRYTAPLPQPAY 153

  Fly    72 SLGSGHTST---------------------------------SSHSANVGVGVGGGALASGSTGG 103
            :..:.||:|                                 ||.|:|.|...|..:.:..:|..
  Fly   154 AAYTPHTATTPATTTVSFLSQPVDYYWYGQRVPTAASPSNTNSSSSSNTGSQSGTLSTSLSNTTN 218

  Fly   104 SGGNSSPD---------------SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNS- 152
            :..|..|:               ...:||:.|::...:|.:.:..:.:|.|::.....|:..|. 
  Fly   219 TNTNMGPNGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKC 283

  Fly   153 RGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQ 217
            :|||||.|:....|..|::.:.|.....|..        :.:||:..    |||:.||...|.|.
  Fly   284 KGYGFVDFEQPAFAECAVKGLQGKGVQAQMA--------KQQEQDPT----NLYIANLPPHFKET 336

  Fly   218 HLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYEN 252
            .|..|...||::.|.:::.|::..|:..||...|:
  Fly   337 DLEAMLSKYGQVVSTRILRDQQMNSKGVGFARMES 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/70 (26%)
RRM3_I_PABPs 202..282 CDD:240826 17/51 (33%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 17/69 (25%)
RRM2_MSSP 322..400 CDD:240690 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.