DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and hfp

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:179 Identity:46/179 - (25%)
Similarity:93/179 - (51%) Gaps:15/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            ::|:.::...:....:...|:.||.|.:.|::.|. ....:|:.||.::..|.|:.|:|::||.|
  Fly   131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGAL 195

  Fly   178 CNNQKVHVVK--FIPRR----DREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML 236
            ...:.:.|.:  .:|:.    |..||:|..|..:||.::..:.:|:.::.:||.:|.|...||  
  Fly   196 MGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAFGPILYCKL-- 258

  Fly   237 DEEGRS----RRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALS 281
             .:|.|    :.:||:.|.|.|:...|:..::...|| .:.|.|.|:::
  Fly   259 -AQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLG-GQLLRVGRSIT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 23/84 (27%)
hfpNP_525123.2 half-pint 10..637 CDD:130706 46/179 (26%)
RRM1_PUF60 130..205 CDD:240816 18/73 (25%)
RRM2_PUF60 227..303 CDD:240817 21/79 (27%)
RRM3_UHM_PUF60 536..636 CDD:241092
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.