DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CG4806

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster


Alignment Length:343 Identity:75/343 - (21%)
Similarity:123/343 - (35%) Gaps:141/343 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VGGGALASG-STGGSGGNSSPDSG--------------------KIYIKNL--ERSIDNKAVYDT 132
            ||....:|| .:....|....|||                    |:.|||:  |:.|.|. |.:.
  Fly   166 VGKEDESSGEDSDAESGEDEEDSGESEDEENDEDHKENKDELKSKLDIKNVKREKQISND-VQEG 229

  Fly   133 FSVFGNILNCNV-AKDED----------------------GNSRGYGFVHFDSEEAARAAIE--- 171
            .:||  |.|... |:|.|                      |:|:|..||.|.::|:|...::   
  Fly   230 CTVF--IKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFKAKESADLCLQAGT 292

  Fly   172 --KV---------------------------------------NGMLCNNQK----VHVVKFIPR 191
              |:                                       .|::....|    |.......|
  Fly   293 EFKLMDEVLDPHPALSREEMKSKQSQENKKDDAKDSRNLYLAREGLIMAGAKAADGVSASDMAKR 357

  Fly   192 RDREQEKATHFKN---------LYVKNLSEEFTEQHLREM------FEPYG-RI-TSHKLMLDE- 238
            .:.||.|....||         |.:.||.:.:..:.|::|      |.|:. |: ..||:..:. 
  Fly   358 HELEQVKTQVLKNLNRFVSRNRLSIHNLPQNYDNEKLKQMALTYTGFRPHECRVMREHKVTPEHP 422

  Fly   239 EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLY-------VA-----RALSK-----AERQ 286
            :|:|:.|||::::..|.||||:     ::|.:|..::       ||     ||:.|     .||.
  Fly   423 QGKSKGFGFLSFDTHQRALAAL-----RKLNNNPNIFGTQSRPIVAFSIEDRAVHKIKEKRTERS 482

  Fly   287 QEIN----RKLEERKRQK 300
            ::.|    .|.:|||.::
  Fly   483 KQNNPTYQNKQQERKERR 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 26/142 (18%)
RRM3_I_PABPs 202..282 CDD:240826 28/109 (26%)
CG4806NP_611955.2 RRM <2..>154 CDD:223796
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861 16/77 (21%)
RRM4_RBM28_like 379..468 CDD:240862 24/93 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.