DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and pAbp

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster


Alignment Length:196 Identity:118/196 - (60%)
Similarity:157/196 - (80%) Gaps:3/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||:|:|||||:|||||.|||||:|.||.||.|||:|||||||::||||..:|:||||||
  Fly    90 GNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGML 154

  Fly   178 CNNQKVHVVKFIPRRDREQ---EKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .|.:||:|.|||||::||:   |||..|.|:||||.:|:|.::.|:|.|||||:|||:|:|..|:
  Fly   155 LNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKED 219

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQI 304
            |:|:.|||||:|..::|.|||..|:||.:|:.|.||||||..|||||||:.||.||.|:::...:
  Fly   220 GKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESV 284

  Fly   305 F 305
            |
  Fly   285 F 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 49/69 (71%)
RRM3_I_PABPs 202..282 CDD:240826 44/79 (56%)
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 118/196 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449312
Domainoid 1 1.000 103 1.000 Domainoid score I2252
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.