DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Dazap1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006241030.1 Gene:Dazap1 / 362836 RGDID:1305280 Length:406 Species:Rattus norvegicus


Alignment Length:194 Identity:49/194 - (25%)
Similarity:87/194 - (44%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGN-SRGYGFVHFDSEEAARAAI------ 170
            ||:::..|:.|...:.:...||.:|.:::|.:.||:..| |||:|||.|.........:      
  Rat    10 GKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHT 74

  Fly   171 ---EKVNGMLCNNQKVHVVKFIPRRDREQE--------KATHFKNLYVKNLSEEFTEQHLREMFE 224
               ..::...|..:.:.     |.|.|.:|        .::....::|..:.....|..|||.|:
  Rat    75 LDGRNIDPKPCTPRGMQ-----PERTRPKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREYFK 134

  Fly   225 PYGRITSHKLMLD-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQ 287
            .:|.:|...::.| |:.|.|.|||:.:|:.||...|| .:|...:...| :.|.||..:..:.|
  Rat   135 KFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAV-NMHFHDIMGKK-VEVKRAEPRDSKNQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/79 (22%)
RRM3_I_PABPs 202..282 CDD:240826 25/80 (31%)
Dazap1XP_006241030.1 RRM1_DAZAP1 11..92 CDD:409988 18/85 (21%)
RRM2_DAZAP1 111..190 CDD:409765 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.