DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PABPC1L2A

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001012995.1 Gene:PABPC1L2A / 340529 HGNCID:27989 Length:200 Species:Homo sapiens


Alignment Length:108 Identity:50/108 - (46%)
Similarity:72/108 - (66%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||.::|||||:|:.||.|||||:|.||.||.| .:|||||||..:|:|..||:.:|||.
Human    90 GNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKG-PKGYGFVHFQKQESAERAIDVMNGMF 153

  Fly   178 CNNQKVHVVKFIPRRDREQEK---ATHFKNLYVKNLSEEFTEQ 217
            .|.:|:.|.:|...::||.|:   |....:..||:..|:..|:
Human   154 LNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 39/69 (57%)
RRM3_I_PABPs 202..282 CDD:240826 4/16 (25%)
PABPC1L2ANP_001012995.1 PABP-1234 2..>196 CDD:130689 49/106 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..200 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.