DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and crp79

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001018242.1 Gene:crp79 / 3361521 PomBaseID:SPAC1610.03c Length:710 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:54/201 - (26%)
Similarity:94/201 - (46%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSI--DNKAVYDTFSVFGNILNCNVA-KDEDGNSRGYGFVHFDSEEAARA 168
            ||..|...:|:|||:.::  ....:.|.||.||:||:..:| ....|.|:|||||.|...|||..
pombe   376 NSPIDPSNLYVKNLDDTVITCKSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAFRQIEAAVR 440

  Fly   169 AIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHK 233
            |.:.:|||:...:::.|.....:.||.:.....|.|   |..||:..:|..:.:|....|.::..
pombe   441 AKDTLNGMMVGKKRIFVCFAERKSDRIRRLQAFFAN---KPTSEQTAQQDNKALFVKPERSSTVT 502

  Fly   234 LMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKR 298
            :....|..:.:..    |||.:..:.|...:..:.|:||        ..::..:.:|.|.|  .:
pombe   503 IRKPIESSTNKIS----ENPTTLSSKVENKNEPKTGENK--------EPSQTNEYVNCKQE--NK 553

  Fly   299 QKAGQI 304
            :.:||:
pombe   554 ELSGQL 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 27/72 (38%)
RRM3_I_PABPs 202..282 CDD:240826 16/79 (20%)
crp79NP_001018242.1 RRM_RBM18 18..106 CDD:240801
RRM 109..>289 CDD:223796
RRM_SF 205..276 CDD:240668
RRM2_I_PABPs 380..459 CDD:240825 29/78 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.