DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Rbp9

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:262 Identity:68/262 - (25%)
Similarity:117/262 - (44%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GNPA---NYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHN 71
            |.||   |....|...|..|.|..       ..||.||..::...|.|.:|:.|:        :|
  Fly    32 GGPATANNVTNSQAQTNGGTTATT-------TAAAGAGSTTNAAVGQATANNAAS--------NN 81

  Fly    72 SLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPD-SGKIYIKNLERSIDNKAVYDTFSV 135
            :..:.:|:.:::              :.:|..:..|:.|| ...:.:..|.:::....:...|..
  Fly    82 NNNNNNTNNNNN--------------NNATANNNNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVS 132

  Fly   136 FGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKA 199
            ||.:.:|.:.:|: .|.|.|||||::..:|.|..||..:||:...|:.:.|  .|.|...|..|.
  Fly   133 FGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKV--SIARPSSESIKG 195

  Fly   200 THFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGL 263
            .   ||||..|.:..|:..|..:|.|||:|.:.:::.|. .|.|:..||:.::....|..|:..|
  Fly   196 A---NLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKEL 257

  Fly   264 HG 265
            :|
  Fly   258 NG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/70 (29%)
RRM3_I_PABPs 202..282 CDD:240826 21/65 (32%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 47/158 (30%)
RRM1_Hu 109..186 CDD:241094 21/78 (27%)
RRM2_Hu 196..274 CDD:241096 21/67 (31%)
RRM3_Hu 355..432 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.