Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_999861.1 | Gene: | syncrip / 326663 | ZFINID: | ZDB-GENE-030131-4862 | Length: | 630 | Species: | Danio rerio |
Alignment Length: | 308 | Identity: | 57/308 - (18%) |
---|---|---|---|
Similarity: | 103/308 - (33%) | Gaps: | 110/308 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 GGGALASGSTGGSGGNSSPDSG-KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRG 154
Fly 155 YGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFI------------------------------ 189
Fly 190 ------------------------------------------------------------PRRDR 194
Fly 195 EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAA 259
Fly 260 VIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQIFYY 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 20/70 (29%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 20/79 (25%) | ||
syncrip | NP_999861.1 | hnRNP-R-Q | 103..622 | CDD:273732 | 57/308 (19%) |
RRM1_hnRNPQ | 161..239 | CDD:240927 | 23/82 (28%) | ||
RRM2_hnRNPQ | 241..325 | CDD:240933 | 0/83 (0%) | ||
RRM3_hnRNPQ | 337..408 | CDD:240939 | 20/78 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |