DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and syncripl

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_955973.1 Gene:syncripl / 324384 ZFINID:ZDB-GENE-030131-3104 Length:560 Species:Danio rerio


Alignment Length:298 Identity:56/298 - (18%)
Similarity:100/298 - (33%) Gaps:105/298 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GGSGGNSSPDSG-KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEE 164
            |.:.....|..| :|::..:.|.:....:...|...|.|.:..:..|. .|.:|||.||.|.::|
Zfish   151 GSTHAGVQPTIGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLSGLNRGYAFVTFCTKE 215

  Fly   165 AARAAIEKVNGMLCNNQKVHVVKFI---------------------------------------- 189
            ||:.|::     ||||.::...|.|                                        
Zfish   216 AAQKAVK-----LCNNNEIRPGKHIGVCISVANNRLFVGSIPKSKTKDQIVEEFAKVTEGLNDVI 275

  Fly   190 --------------------------------------------------PRRDREQEKATHFKN 204
                                                              |..|.:.|.....|.
Zfish   276 LYHQPDDKKKNRGFCFLGYEDHKTAAQARRRLMSGKVKVWGNVVTVEWADPIEDPDPEVMAKVKV 340

  Fly   205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            |:|:||:...||:.|.:.|..:|::...|.:.|       :.|:.:|....|:.|:..||||.| 
Zfish   341 LFVRNLASTVTEELLEKTFCQFGKLERVKKLKD-------YAFIHFEERDGAVKALAELHGKDL- 397

  Fly   270 DNKFLYVARALSKAERQQEINRKLEERKRQKAGQIFYY 307
            :.:.:.:..|....::::|...:.:..|.|...:.:||
Zfish   398 EGEPIEIVFAKPPDQKRKERKAQRQAAKTQMYDEYYYY 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/70 (30%)
RRM3_I_PABPs 202..282 CDD:240826 22/79 (28%)
syncriplNP_955973.1 RRM1_hnRNPQ 162..240 CDD:240927 24/82 (29%)
RRM_SF 242..326 CDD:302621 0/83 (0%)
RRM3_hnRNPR 338..409 CDD:240938 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.