Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955973.1 | Gene: | syncripl / 324384 | ZFINID: | ZDB-GENE-030131-3104 | Length: | 560 | Species: | Danio rerio |
Alignment Length: | 298 | Identity: | 56/298 - (18%) |
---|---|---|---|
Similarity: | 100/298 - (33%) | Gaps: | 105/298 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 GGSGGNSSPDSG-KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEE 164
Fly 165 AARAAIEKVNGMLCNNQKVHVVKFI---------------------------------------- 189
Fly 190 --------------------------------------------------PRRDREQEKATHFKN 204
Fly 205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
Fly 270 DNKFLYVARALSKAERQQEINRKLEERKRQKAGQIFYY 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 21/70 (30%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 22/79 (28%) | ||
syncripl | NP_955973.1 | RRM1_hnRNPQ | 162..240 | CDD:240927 | 24/82 (29%) |
RRM_SF | 242..326 | CDD:302621 | 0/83 (0%) | ||
RRM3_hnRNPR | 338..409 | CDD:240938 | 22/78 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |