DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and fne

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:190 Identity:51/190 - (26%)
Similarity:87/190 - (45%) Gaps:26/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGSTGGSGGNSSPDSGKIYIKN-LERSIDNKAVYDTFSVFGNILNCNVAKD-------------- 147
            :||..||...|:.:|....|.| |.:::..:.:...||..|.:.:|.:.:|              
  Fly    10 NGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTA 74

  Fly   148 -----EDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYV 207
                 :.|.|.|||||::...|.|..|:..:||:...| ||..|.:.    |...::....||||
  Fly    75 LNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQN-KVIKVSYA----RPSSESIKGANLYV 134

  Fly   208 KNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGK 266
            ..|.:..::..|..||..:|:|.:.:::.|. .|.|:..||:.::....|..|:..|:||
  Fly   135 SGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/89 (26%)
RRM3_I_PABPs 202..282 CDD:240826 20/66 (30%)
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 46/177 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.