DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Celf5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001361632.1 Gene:Celf5 / 319586 MGIID:2442333 Length:446 Species:Mus musculus


Alignment Length:348 Identity:59/348 - (16%)
Similarity:95/348 - (27%) Gaps:183/348 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDS 162
            |.|.||.       ..|:::..|.:....:.|...|..||.|..|.|.:..||:|:|..||.|.|
Mouse    88 SESRGGR-------DRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSS 145

  Fly   163 EEAARAAIEKVNGML-------------------------------------------------- 177
            ...|:|||..::|..                                                  
Mouse   146 HTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYA 210

  Fly   178 --------------------------CNNQKV--------------------------------- 183
                                      |:.|::                                 
Mouse   211 QALMQQQTTVLSTSGSYLSPGVAFPPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTAAVPGL 275

  Fly   184 ----------------------------------------------------------------- 183
                                                                             
Mouse   276 MAPIPNGFPGVLPFPGSHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAIAPV 340

  Fly   184 -HVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFG 246
             |.|...|...::|.:.....||::.:|.:||.:..|.:||.|:|.|.|.|:.:|. ..:|:.||
Mouse   341 AHSVPQPPHLLQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFG 405

  Fly   247 FVAYENPQSALAAVIGLHGKQLG 269
            ||::::|.||.||:..::|.|:|
Mouse   406 FVSFDHPASAQAAIQAMNGFQIG 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/244 (9%)
RRM3_I_PABPs 202..282 CDD:240826 27/69 (39%)
Celf5NP_001361632.1 RRM1_CELF3_4_5_6 2..88 CDD:241076 59/348 (17%)
PABP-1234 <9..358 CDD:130689 32/276 (12%)
RRM2_CELF3_4_5_6 95..175 CDD:241079 22/79 (28%)
RRM3_CELF3_4_5_6 357..435 CDD:241083 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.