Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001361632.1 | Gene: | Celf5 / 319586 | MGIID: | 2442333 | Length: | 446 | Species: | Mus musculus |
Alignment Length: | 348 | Identity: | 59/348 - (16%) |
---|---|---|---|
Similarity: | 95/348 - (27%) | Gaps: | 183/348 - (52%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 SGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDS 162
Fly 163 EEAARAAIEKVNGML-------------------------------------------------- 177
Fly 178 --------------------------CNNQKV--------------------------------- 183
Fly 184 ----------------------------------------------------------------- 183
Fly 184 -HVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFG 246
Fly 247 FVAYENPQSALAAVIGLHGKQLG 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 23/244 (9%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 27/69 (39%) | ||
Celf5 | NP_001361632.1 | RRM1_CELF3_4_5_6 | 2..88 | CDD:241076 | 59/348 (17%) |
PABP-1234 | <9..358 | CDD:130689 | 32/276 (12%) | ||
RRM2_CELF3_4_5_6 | 95..175 | CDD:241079 | 22/79 (28%) | ||
RRM3_CELF3_4_5_6 | 357..435 | CDD:241083 | 27/72 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |