DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and HNRNPD

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_112738.1 Gene:HNRNPD / 3184 HGNCID:5036 Length:355 Species:Homo sapiens


Alignment Length:300 Identity:77/300 - (25%)
Similarity:129/300 - (43%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALA 97
            ::|.....|||...:.|||..........||..|              ::.:|..|.|.|||..:
Human     3 EEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQG--------------AAAAAGSGAGTGGGTAS 53

  Fly    98 SGSTGGSG------------------GNSSP----------DSGKIYIKNLERSIDNKAVYDTFS 134
            .|:.|||.                  .||||          :..|::|..|......|.:.|.||
Human    54 GGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFS 118

  Fly   135 VFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV--KFI-PRRDRE 195
            .||.:::|.:..|. .|.|||:|||.|...|    :::||     .:||.|.:  |.| |:|.:.
Human   119 KFGEVVDCTLKLDPITGRSRGFGFVLFKESE----SVDKV-----MDQKEHKLNGKVIDPKRAKA 174

  Fly   196 QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAYENPQSALAA 259
            .:.....|.::|..||.:..|:.:||.|..:|.:.|.:|.:|.:...|| |.|:.::..:..   
Human   175 MKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPV--- 236

  Fly   260 VIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQ 299
                  |::.:.|:..|  .|||.|.:..::::..::::|
Human   237 ------KKIMEKKYHNV--GLSKCEIKVAMSKEQYQQQQQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/70 (33%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)
HNRNPDNP_112738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 24/102 (24%)
CBFNT <60..78 CDD:311868 1/17 (6%)
RRM1_hnRNPD 99..172 CDD:410150 27/81 (33%)
RRM2_hnRNPD 183..257 CDD:241027 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.