DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and HNRNPAB

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:249 Identity:66/249 - (26%)
Similarity:119/249 - (47%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HGHNSLGSGHTSTSSHSANVGVGVG-GGALA---SGSTGGSGGN------SSPDSGKIYIKNLER 122
            :||.::..|.   |...|..|...| |||.|   ||:..|:.|:      :..|:||:::..|..
Human    18 NGHEAVPEGE---SPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSW 79

  Fly   123 SIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV 186
            ....|.:.|.|:.||.:::|.:..|.: |.|||:||:.|..    .|::|||     .:||.|.:
Human    80 DTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKD----AASVEKV-----LDQKEHRL 135

  Fly   187 --KFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFV 248
              :.|..:.....|....|.::|..|:.|.||:.:||.|..:|.|.:.:|.:|.:...|| |.|:
Human   136 DGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFI 200

  Fly   249 AYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
            .::..:..         |::.:.||    ..:|.::.:.::.:..|..::|:.|
Human   201 TFKEEEPV---------KKVLEKKF----HTVSGSKCEIKVAQPKEVYQQQQYG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/70 (30%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 16/54 (30%)
RRM1_hnRNPAB 66..145 CDD:410151 26/87 (30%)
RRM2_hnRNPAB 150..229 CDD:409997 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.