DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Spx

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:177 Identity:50/177 - (28%)
Similarity:89/177 - (50%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            ||...|:..:....:::.|...|.::|.::.||. ....:|||||.|.|||.|...|:.:|    
  Fly    15 IYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMN---- 75

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFKNL------YVKNLSEEFTEQHLREMFEPYGRI-TSHKLML 236
                  ::|...:..|..:.:.|.|||      ::.||..|..|:.|.:.|..:|.| .:.|:|.
  Fly    76 ------MIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMR 134

  Fly   237 D-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSK 282
            | |.|:|:.|.|:.:.:.:::.||:..::|:.| .|:.:.|:.|..|
  Fly   135 DPETGKSKSFAFINFASFEASDAAMDAMNGQYL-CNRPISVSYAFKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/70 (29%)
RRM3_I_PABPs 202..282 CDD:240826 26/87 (30%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 22/82 (27%)
RRM2_SF3B4 99..181 CDD:240781 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.