DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Cstf2t

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001101056.1 Gene:Cstf2t / 309338 RGDID:1310026 Length:629 Species:Rattus norvegicus


Alignment Length:99 Identity:28/99 - (28%)
Similarity:57/99 - (57%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENP 253
            |..||.      .::::|.|:..|.||:.|:::|...|.:.|.:|:.|.| |:.:.:||..|::.
  Rat     9 PAMDRS------LRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQ 67

  Fly   254 QSALAAVIGLHGKQLGDNKFLYVARALSKAERQQ 287
            ::||:|:..|:|::. ..:.|.|..|.|:..:::
  Rat    68 ETALSAMRNLNGREF-SGRALRVDNAASEKNKEE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825
RRM3_I_PABPs 202..282 CDD:240826 24/80 (30%)
Cstf2tNP_001101056.1 RRM <16..>109 CDD:223796 25/86 (29%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 23/74 (31%)
CSTF2_hinge 113..191 CDD:291025
CSTF_C 585..625 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.