DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and U2af2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_003748811.1 Gene:U2af2 / 308335 RGDID:1310690 Length:475 Species:Rattus norvegicus


Alignment Length:209 Identity:43/209 - (20%)
Similarity:83/209 - (39%) Gaps:48/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GGNSSPDSGKIYIKNLERSIDNKAVYDTFSVF----------GN-ILNCNVAKDEDGNSRGYGFV 158
            |...:..:.::|:.|:...|..:|:.|.|:..          || :|...:.:|     :.:.|:
  Rat   141 GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQD-----KNFAFL 200

  Fly   159 HFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQE----------------------KATH 201
            .|.|.:....|: ..:|::...|.:.:     ||..:.:                      .:.|
  Rat   201 EFRSVDETTQAM-AFDGIIFQGQSLKI-----RRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAH 259

  Fly   202 FKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHG 265
              .|::..|.....:..::|:...:|.:.:..|:.|. .|.|:.:.|..|.:......|:.||:|
  Rat   260 --KLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNG 322

  Fly   266 KQLGDNKFLYVARA 279
            .||||.|.| |.||
  Rat   323 MQLGDKKLL-VQRA 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/80 (20%)
RRM3_I_PABPs 202..282 CDD:240826 23/79 (29%)
U2af2XP_003748811.1 U2AF_lg 63..474 CDD:273727 43/209 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.