DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Celf4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_038952808.1 Gene:Celf4 / 307540 RGDID:1307630 Length:583 Species:Rattus norvegicus


Alignment Length:262 Identity:68/262 - (25%)
Similarity:110/262 - (41%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SLGSGHTSTSSHSANVGVGVGGGALASGSTGG---SGGNSSP------DSGKIYIKNLERSIDNK 127
            :|.:|....:|.|.|   |:|....::|...|   |.||.|.      |:.|::|..:.|::|.|
  Rat     7 TLANGQADNASLSTN---GLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEK 68

  Fly   128 AVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPR 191
            .:...|..||.|....|.||. .|..:|..|:.:...|:|..|          ...:|..|.:|.
  Rat    69 DLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA----------QSALHEQKTLPG 123

  Fly   192 RDRE-----------------QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .:|.                 ::..:..:.|:|..|:::.:|..:|.:||.:|.|....::...:
  Rat   124 MNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPD 188

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQL--GDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
            |.|:...||.|.:...|.||:..|||.|.  |.:..|.|..|.:..||..       .|.:|.||
  Rat   189 GNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTM-------RRMQQMAG 246

  Fly   303 QI 304
            |:
  Rat   247 QM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 25/81 (31%)
Celf4XP_038952808.1 RRM1_CELF3_4_5_6 49..135 CDD:410041 23/95 (24%)
PABP-1234 <56..378 CDD:130689 53/210 (25%)
RRM2_CELF3_4_5_6 151..231 CDD:410043 24/79 (30%)
RRM_SF 417..>465 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.