DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc1l2a

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006257212.1 Gene:Pabpc1l2a / 302405 RGDID:1566367 Length:229 Species:Rattus norvegicus


Alignment Length:86 Identity:45/86 - (52%)
Similarity:63/86 - (73%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||.::|||||:|:.||.|||||:|.||.||.| .:|||||||..:|:|..||:.:|||.
  Rat   119 GNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKG-PKGYGFVHFQKQESAERAIDALNGMF 182

  Fly   178 CNNQKVHVVKFIPRRDREQEK 198
            .|.:|:.|.:|...::||.|:
  Rat   183 LNYRKIFVGRFKSHKEREAER 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 39/69 (57%)
RRM3_I_PABPs 202..282 CDD:240826
Pabpc1l2aXP_006257212.1 PABP-1234 31..>201 CDD:130689 43/82 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.