DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc4l

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001099899.1 Gene:Pabpc4l / 295010 RGDID:1559517 Length:370 Species:Rattus norvegicus


Alignment Length:247 Identity:89/247 - (36%)
Similarity:143/247 - (57%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNS-------------SPDSGKIYIKNLE 121
            |.|||.|:.:.      :.||....||.:.:.....|.|             ....|.::||||:
  Rat    48 HRSLGYGYVNF------LQVGDAQKALETMNFDLIKGKSIRLMWSQRDACLRKSGIGNVFIKNLD 106

  Fly   122 RSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV 186
            :|||||.:|:.||.||.|::..|..||:| |:||||||:..:.||..|||::||.|..:..:.|.
  Rat   107 KSIDNKTLYEHFSPFGKIMSSKVMTDEEG-SKGYGFVHYQDQRAADRAIEEMNGKLLRDSTLFVA 170

  Fly   187 KFIPRRDRE---QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFV 248
            :|..|:|||   :||...|.|:|:||..::..::.||.:|..||:..|.|:|.|..|:|:|||||
  Rat   171 RFKSRKDREAELREKPAEFTNVYIKNFGDDMDDESLRSVFSKYGQTLSVKVMKDASGKSKRFGFV 235

  Fly   249 AYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            ::::.::|..||..::|:.: :.:.::|.||..|.|||.|:....|:.|:::
  Rat   236 SFDSHKAAKNAVEDMNGRDI-NGQTIFVGRAQKKVERQAELKEMFEQMKKER 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 34/69 (49%)
RRM3_I_PABPs 202..282 CDD:240826 28/79 (35%)
Pabpc4lNP_001099899.1 ELAV_HUD_SF 11..262 CDD:273741 79/221 (36%)
RRM1_I_PABPs 11..89 CDD:240824 11/46 (24%)
RRM2_I_PABPs 96..171 CDD:240825 36/75 (48%)
RRM3_I_PABPs 189..268 CDD:240826 28/79 (35%)
RRM_SF 293..369 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52254
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.