DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001099621.1 Gene:Pabpc2 / 291615 RGDID:1310759 Length:630 Species:Rattus norvegicus


Alignment Length:186 Identity:90/186 - (48%)
Similarity:130/186 - (69%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||.::|||||:|||||.|||||:|.|..||:| |:|:|||||::||||..||||:||||
  Rat    99 GNVFIKNLNKTIDNKALYDTFSAFGNILSCKVVCDENG-SKGHGFVHFETEEAAERAIEKMNGML 162

  Fly   178 CNNQKVHVVKFIPRRDREQEKAT---HFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .|::||.|.:|..|::||.|..|   .|.|:|:||..:...::.|..:|..:|::.|.|:|.||.
  Rat   163 LNDRKVFVGQFKSRKEREAELGTRTKEFTNVYIKNFGDRMDDKTLNGLFGRFGQVLSVKVMTDEG 227

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEE 295
            |:|:.||||::|..:.|..||..::||:| :.|.:||..|..|.:|..|:.||.|:
  Rat   228 GKSKGFGFVSFERHEDAQKAVDEMNGKEL-NGKHIYVGPAQKKVDRHIELKRKFEQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 46/69 (67%)
RRM3_I_PABPs 202..282 CDD:240826 30/79 (38%)
Pabpc2NP_001099621.1 PABP-1234 11..609 CDD:130689 90/186 (48%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..171 CDD:240825 47/72 (65%)
RRM3_I_PABPs 190..269 CDD:240826 30/79 (38%)
RRM4_I_PABPs 293..370 CDD:240827
PABP 542..608 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.