DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Rbm45

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_695218.1 Gene:Rbm45 / 266631 RGDID:628862 Length:476 Species:Rattus norvegicus


Alignment Length:180 Identity:51/180 - (28%)
Similarity:87/180 - (48%) Gaps:22/180 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGSTGGSGG-------NSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRG 154
            :||:|||||       ...|.:.:|::. :.:......:.:.||.||:|.:..|.:|: ...|:|
  Rat     4 AGSSGGSGGFRPGVDSLDEPPNSRIFLV-ISKYTSESVLREHFSPFGDIQDIWVVRDKHTKESKG 67

  Fly   155 YGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVK-FIPR-------RDREQEKATHFKNLYVKNLS 211
            ..||.|.....|..|:|:::|..........:| ||.:       ||.|.|:.|   .::|. :.
  Rat    68 IAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELT---RIFVM-IP 128

  Fly   212 EEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAV 260
            :.:||:.|||.|:.||.|....::.:: .|.|:..|:|.|..|..|..|:
  Rat   129 KSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPSQAAQAI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 18/60 (30%)
Rbm45NP_695218.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 7/15 (47%)
RRM1_RBM45 23..104 CDD:240812 20/81 (25%)
RRM2_RBM45 120..193 CDD:240813 19/63 (30%)
RRM3_RBM45 248..320 CDD:240814
RRM4_RBM45 393..460 CDD:240815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.