DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and gar2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_593531.1 Gene:gar2 / 2542869 PomBaseID:SPAC140.02 Length:500 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:58/232 - (25%)
Similarity:100/232 - (43%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGK------------------------ 114
            ||..:|:.|.|::......|.  :..|:.....:||.|..|                        
pombe   200 GSSESSSDSESSSDSSSESGD--SDSSSDSESESSSEDEKKRKAEPASEERPAKITKPSQDSNET 262

  Fly   115 --IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAI-----E 171
              :::..|..::|::.:...|..:|.|:...|..| :.|.|:|||:|.|::.|||:||:     :
pombe   263 CTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAANGTK 327

  Fly   172 KVNGMLCNNQKVHVVKFIPR----RDREQEKATHF--------KNLYVKNLSEEFTEQHLREMFE 224
            :::|.:.|....:     ||    :...|::|.:|        ..::|.|||...||..|...|.
pombe   328 EIDGRMVNLDLSN-----PRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNATEDDLSTAFG 387

  Fly   225 PYGRITSHKLMLD-EEGRSRRFGFVAYENPQSALAAV 260
            ..|.|.|.:|..| :.||.:.||:|.:.:..||...|
pombe   388 GCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/75 (28%)
RRM3_I_PABPs 202..282 CDD:240826 22/68 (32%)
gar2NP_593531.1 RRM1_gar2 264..339 CDD:240893 21/74 (28%)
RRM2_gar2 368..439 CDD:240894 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.