DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and SPAC328.05

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_594207.3 Gene:SPAC328.05 / 2542567 PomBaseID:SPAC328.05 Length:464 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:53/223 - (23%)
Similarity:90/223 - (40%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RH--GHNSLGSG------HTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERS 123
            ||  |.|||..|      ||....|.                  |:|...:....::|:.||...
pombe    41 RHVNGSNSLKRGLHFDGEHTERDPHL------------------GNGQKYTQQERRVYVGNLSYQ 87

  Fly   124 IDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKF 188
            :....:.:.....||:|||.:....:|.|:|...:.:.:.|.||.||:.::......:.|::   
pombe    88 VRWFELKEFMGQVGNVLNCEILNLPNGLSKGCAIIEYSTAEEARTAIKTLSNQKFMGRLVYI--- 149

  Fly   189 IPRRDREQ-----------------EKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML 236
              |.||||                 :.:...:.|:|.||......|.|:::|...|.:....:.:
pombe   150 --REDREQNARFGSSSVSPSASSNGKDSEPDRQLFVGNLPYNVRWQDLKDLFRQAGSVIRADIQM 212

  Fly   237 DEEGRSRRFGFVAYENPQSALAAVIGLH 264
            ::|||||..|.|...:.:.|:.|:..||
pombe   213 NQEGRSRGIGIVVMSSMKEAMHAIQMLH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/69 (25%)
RRM3_I_PABPs 202..282 CDD:240826 19/63 (30%)
SPAC328.05NP_594207.3 RRM 71..387 CDD:223796 41/175 (23%)
RRM_SF 79..150 CDD:240668 17/75 (23%)
RRM3_hnRNPM_like 181..252 CDD:240833 19/60 (32%)
RRM_SF 312..385 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.