DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and pabp

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_593377.1 Gene:pabp / 2541505 PomBaseID:SPAC57A7.04c Length:653 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:96/193 - (49%)
Similarity:133/193 - (68%) Gaps:6/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGM 176
            :|.::||||:.:|||||::||||.||.||:|.||.||.||::|||||||||.|:|.||||.||||
pombe   167 TGNVFIKNLDPAIDNKALHDTFSAFGKILSCKVAVDELGNAKGYGFVHFDSVESANAAIEHVNGM 231

  Fly   177 LCNNQKVHVVKFIPRRDREQE----KATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD 237
            |.|::||:|...:.||:|:.:    || :|.|:|:|||..|.|||...::|..:|.|||..|:.|
pombe   232 LLNDKKVYVGHHVSRRERQSKVEALKA-NFTNVYIKNLDTEITEQEFSDLFGQFGEITSLSLVKD 295

  Fly   238 EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            :..:.|.||||.|.|.:.|..||..|:.|:....| |||.||..|.||::|:.::.|:.|.:|
pombe   296 QNDKPRGFGFVNYANHECAQKAVDELNDKEYKGKK-LYVGRAQKKHEREEELRKRYEQMKLEK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 47/69 (68%)
RRM3_I_PABPs 202..282 CDD:240826 35/79 (44%)
pabpNP_593377.1 PABP-1234 80..642 CDD:130689 96/193 (50%)
RRM1_I_PABPs 81..160 CDD:240824
RRM2_I_PABPs 166..242 CDD:240825 49/74 (66%)
RRM3_I_PABPs 260..339 CDD:240826 35/79 (44%)
RRM4_I_PABPs 363..441 CDD:240827
PolyA 581..644 CDD:197769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.