DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and SPBP22H7.02c

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_595599.1 Gene:SPBP22H7.02c / 2541303 PomBaseID:SPBP22H7.02c Length:833 Species:Schizosaccharomyces pombe


Alignment Length:215 Identity:49/215 - (22%)
Similarity:90/215 - (41%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGN------SRGYGFVHFD 161
            |:....|.|:..||:|||..|...:.....|......|:..:....|..      |.|:|||.|.
pombe   609 GTEDIESLDTATIYVKNLNFSTKQEEFQKVFKPLEGYLSAVIRAKPDPKRPGKYLSMGFGFVEFK 673

  Fly   162 SEEAARAAIEKVNGMLCNNQKVHV---------VKFIPRRDREQEKATHFKNLYVKNLSEEFTEQ 217
            .:.:|.||:..:||.:.:..|:.:         ...:.::|..:.|.|   .:.:|||..|.|::
pombe   674 DKASAVAAMHAMNGFVLDGHKLEIKLSHQGVDAAAEVRKQDSSKPKGT---KILIKNLPFEATKK 735

  Fly   218 HLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQ-LGDNKFLYVARALS 281
            .::.:...||::.|.::....:..:|.|.|..:...:.|..|:..|.... ||.:..|..|...:
pombe   736 DVQSLLGAYGQLRSVRVPKKFDRSARGFAFAEFVTAREAANAMRALKNTHLLGRHLVLQYASNAT 800

  Fly   282 KAERQQEINRKLEERKRQKA 301
            ..:.|..|.:..:|...:.|
pombe   801 MDDMQHAIEKMAKEANAEAA 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/75 (28%)
RRM3_I_PABPs 202..282 CDD:240826 18/80 (23%)
SPBP22H7.02cNP_595599.1 RRM <2..>102 CDD:223796
RRM1_MRD1 2..81 CDD:241009
RRM 232..>421 CDD:223796
RRM2_MRD1 321..399 CDD:241010
RRM3_MRD1 506..577 CDD:241012
ELAV_HUD_SF 508..799 CDD:273741 45/192 (23%)
RRM_SF 619..702 CDD:302621 21/82 (26%)
RRM5_MRD1 721..796 CDD:241014 18/77 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.