DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and SPBC23E6.01c

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_596601.2 Gene:SPBC23E6.01c / 2540551 PomBaseID:SPBC23E6.01c Length:473 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:65/248 - (26%)
Similarity:109/248 - (43%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKN 119
            ||.|.|::|:       |:.:.....::|...:....||| |...|.      |......|::.:
pombe   142 ASPHEASSAM-------SMNNKPIPGTNHLFKLNWASGGG-LREKSI------SKASEYSIFVGD 192

  Fly   120 LERSIDNKAVYDTFSVFGNILN-CNVAK---DEDGN-SRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            |..:::.   :|.:|:|.:..| |..||   |...| |||||||.|..|...::|:.::.|.:|.
pombe   193 LSPNVNE---FDVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSALAEMQGQICG 254

  Fly   180 NQ-----------KVHV---VKFIP-----------RRDREQEKATHFKNLYVKNLSEEFTEQHL 219
            ::           |.||   |..:|           .:...|...|....::|..||:..:|:.|
pombe   255 DRPIRVGLATPKSKAHVFSPVNVVPVSMPPVGFYSAAQPVPQFADTANSTVFVGGLSKFVSEEEL 319

  Fly   220 REMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNK 272
            :.:|:.:|.|...|:   ..|:.  .|||.:.|.|||..|:..|.|..||:::
pombe   320 KYLFQNFGEIVYVKI---PPGKG--CGFVQFVNRQSAEIAINQLQGYPLGNSR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 24/85 (28%)
RRM3_I_PABPs 202..282 CDD:240826 22/71 (31%)
SPBC23E6.01cNP_596601.2 RRM 70..376 CDD:223796 65/248 (26%)
RRM1_NGR1_NAM8_like 94..173 CDD:241055 7/37 (19%)
RRM2_NGR1_NAM8_like 185..264 CDD:241057 23/81 (28%)
RRM3_NGR1_NAM8_like 302..373 CDD:240792 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.