DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and bru2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:321 Identity:81/321 - (25%)
Similarity:118/321 - (36%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NPANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGS 75
            :||:|   .|.||.|     |..:...||:.   |...:||..|||...|||..    ..|.||.
  Fly   594 SPAHY---LPGLNFH-----HPPENSAHHSQ---HSPGIGGASAASLSAAAATA----ASNPLGG 643

  Fly    76 GHTSTSSHSANVGVGVGGGALA---------------------------SGSTGGSGGNSSPDSG 113
            ....|.:.:::.|...|.|.||                           |.|:|.:.||||..||
  Fly   644 APPPTPTPTSSAGHAAGAGLLAAPSMSMQNLVALLATPTAHHQLSLHHSSSSSGHNNGNSSATSG 708

  Fly   114 ------------------KIYIKNLERSIDNKAV------YDTFSVFGNILNCNVAKDEDG---- 150
                              ..|  |:.:.|.:.|.      ......|..:...|.|.....    
  Fly   709 LHNQRLTYAAAPPPPPISTTY--NMPQLIGHTATPTQPGGSSQSLTFNALWPPNAADPYSSSLSG 771

  Fly   151 --NSRGYGFVHFD-SEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSE 212
              |...||..... :..|.:||...|.|                   :|.:.....||::.:|.:
  Fly   772 LTNGAAYGAASQPVTTSALQAAAAGVTG-------------------KQIEGPDGSNLFIYHLPQ 817

  Fly   213 EFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNK 272
            ||.:..|...|.|:|.:.|.|:.:|:: ..|:.||||:|:||.||.||:..:||.|:|..:
  Fly   818 EFIDTDLASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKR 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/82 (18%)
RRM3_I_PABPs 202..282 CDD:240826 28/72 (39%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075
RRM2_Bruno_like 381..461 CDD:241080
RRM_SF 801..892 CDD:302621 29/78 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.