DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc4l

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001094949.1 Gene:Pabpc4l / 241989 MGIID:3643087 Length:370 Species:Mus musculus


Alignment Length:191 Identity:78/191 - (40%)
Similarity:124/191 - (64%) Gaps:5/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||::|||||.:|:.||.||.|::..|..|.:| |:||||||:....||..|||::||.|
Mouse    98 GNVFIKNLDKSIDNKTLYEHFSPFGTIMSSKVMTDGEG-SKGYGFVHYQDRRAADRAIEEMNGKL 161

  Fly   178 CNNQKVHVVKFIPRRDREQE---KATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .....:.|.:|..|:|||.|   |.|.|.|:|:||..::..::.|||:|..||:..|.|:|.|..
Mouse   162 LRESTLFVARFKSRKDREAELRDKPTEFTNVYIKNFGDDVDDEKLREVFSKYGQTLSVKVMKDAT 226

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            |:|:.||||::::.::|..||..::|:.: :.:.::|.||..|.|||.|:....|:.|:::
Mouse   227 GKSKGFGFVSFDSHEAAKNAVEDMNGQDI-NGQTIFVGRAQKKVERQAELKEMFEQMKKER 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 33/69 (48%)
RRM3_I_PABPs 202..282 CDD:240826 28/79 (35%)
Pabpc4lNP_001094949.1 PABP-1234 10..>369 CDD:130689 78/191 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52254
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.