DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and RBFOX2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006724248.1 Gene:RBFOX2 / 23543 HGNCID:9906 Length:465 Species:Homo sapiens


Alignment Length:155 Identity:42/155 - (27%)
Similarity:68/155 - (43%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AAVLGRHGHNSLGS--GHTSTSSHSANVGVG----VGGGALASG------STGGSGGNSSPDSGK 114
            |...|.|.....||  .|...||:|.:...|    ..|||...|      |:..|...|:|.  :
Human   121 AGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPK--R 183

  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            :::.|:.....:..:...|..||.||:..:..:|.| |:|:|||.|::...|..|.||::|.:..
Human   184 LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERG-SKGFGFVTFENSADADRAREKLHGTVVE 247

  Fly   180 NQKVHVVKFIPRRDREQEKATHFKN 204
            .:|:.|.....|....::..|.:.|
Human   248 GRKIEVNNATARVMTNKKMVTPYAN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/69 (29%)
RRM3_I_PABPs 202..282 CDD:240826 1/3 (33%)
RBFOX2XP_006724248.1 RRM <165..>266 CDD:223796 26/103 (25%)
RRM_FOX1_like 182..257 CDD:240853 21/77 (27%)
Fox-1_C 326..>383 CDD:289199
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.