DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PUF60

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001349824.1 Gene:PUF60 / 22827 HGNCID:17042 Length:596 Species:Homo sapiens


Alignment Length:176 Identity:43/176 - (24%)
Similarity:96/176 - (54%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            ::|:.::...:....:...|:.||.|.:.:::.|. ....:|:.||.::..|||:.|:|::|.::
Human   167 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVM 231

  Fly   178 CNNQKV------HVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML 236
            ...:.:      ::.:..|..|:..|:|..|..:||.::.::.::..::.:||.:|:|.|..|..
Human   232 LGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLAR 296

  Fly   237 D-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALS 281
            | ..|:.:.:||:.||..||:..||..::...|| .::|.|.:|::
Human   297 DPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLG-GQYLRVGKAVT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/76 (20%)
RRM3_I_PABPs 202..282 CDD:240826 24/81 (30%)
PUF60NP_001349824.1 half-pint 44..596 CDD:130706 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.