DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_035163.1 Gene:Pabpc2 / 18459 MGIID:1349723 Length:628 Species:Mus musculus


Alignment Length:192 Identity:91/192 - (47%)
Similarity:133/192 - (69%) Gaps:5/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||.::|||||:|||||.|||||:|.|..||:| |:|:|||||::||||..||||:||||
Mouse    99 GNVFIKNLNKTIDNKALYDTFSAFGNILSCKVVSDENG-SKGHGFVHFETEEAAERAIEKMNGML 162

  Fly   178 CNNQKVHVVKFIPRRDREQEKAT---HFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .|::||.|.:|..:::||.|..|   .|.|:|:||..:...::.|..:|..:|:|.|.|:|.||.
Mouse   163 LNDRKVFVGRFKSQKEREAELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKVMTDEG 227

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKA 301
            |:|:.||||::|..:.|..||..::||:| :.|.:||.||..|.:|..|:..|.|:..:.|:
Mouse   228 GKSKGFGFVSFERHEDAQKAVDEMNGKEL-NGKHIYVGRAQKKDDRHTELKHKFEQVTQDKS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 46/69 (67%)
RRM3_I_PABPs 202..282 CDD:240826 32/79 (41%)
Pabpc2NP_035163.1 PABP-1234 11..607 CDD:130689 91/192 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.