DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and pab-2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001379081.1 Gene:pab-2 / 181473 WormBaseID:WBGene00003903 Length:692 Species:Caenorhabditis elegans


Alignment Length:193 Identity:94/193 - (48%)
Similarity:132/193 - (68%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGM 176
            :|.|:||||:|.||||:||||||:|||||:|.||.|::|||:|||||||::|.:|:.||||||||
 Worm   144 NGNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDEGNSKGYGFVHFETEHSAQTAIEKVNGM 208

  Fly   177 LCNNQKVHVVKFIPRRDREQ---EKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE 238
            |.:::||:|.||.||..|.:   |....:.|::|||..|...::.|..||..:|.|||..:|.|.
 Worm   209 LLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDA 273

  Fly   239 EGRSRRFGFVAYENPQSALAAVIGLHGKQL-GDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            :|:.:.|||||:.:..:|..||..|:...| |.:..|.|.||..|:||..|:.||.|..|:::
 Worm   274 QGKPKGFGFVAFADQDAAGQAVEKLNDSILEGTDCKLSVCRAQKKSERSAELKRKYEALKQER 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 48/69 (70%)
RRM3_I_PABPs 202..282 CDD:240826 30/80 (38%)
pab-2NP_001379081.1 PABP-1234 57..675 CDD:130689 94/193 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.