DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and hrpa-2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:216 Identity:50/216 - (23%)
Similarity:95/216 - (43%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHFDSEEAARAAI 170
            :|.|...|::|..|.....::.:.:.||.:|.:::..|.:|.: .:|||:|||.|.|..:|.:|:
 Worm    64 DSPPQLRKLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAM 128

  Fly   171 ----EKVNGMLCNNQKVHVVKFIPRRDR---------EQEKATHFKNLYVKNLSEEFTEQHLREM 222
                .|:.|...::::.     |||...         |.:.|...|.|.....:...:...||..
 Worm   129 NDRPHKLGGKTVDSKRA-----IPREQMSSMIPPPFFETDPAPGCKLLLNGITNGVHSVDSLRVY 188

  Fly   223 FEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGD-------------NKFL 274
            ||.:|.:...:::    |:.|..|||.||:.:||...:....|:.:.:             |...
 Worm   189 FETFGTLDQVEIL----GQPRGLGFVIYEDKESADRCLAHNSGRHIVNERKIEVRVFTKHPNGST 249

  Fly   275 YVARALSKAERQQEINRKLEE 295
            |..|..|::..|:::..:|.:
 Worm   250 YWKRPQSQSHSQRDLFEQLSQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/74 (26%)
RRM3_I_PABPs 202..282 CDD:240826 20/92 (22%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 44/174 (25%)
RRM1_hnRNPA_like 71..148 CDD:241022 21/81 (26%)
RRM_SF 183..240 CDD:302621 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.