DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and sart-3

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_502136.1 Gene:sart-3 / 178053 WormBaseID:WBGene00007111 Length:836 Species:Caenorhabditis elegans


Alignment Length:237 Identity:50/237 - (21%)
Similarity:93/237 - (39%) Gaps:59/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE----------- 148
            |.:|.:...|..:|:|..|...::......:     |..::|.:.|:....:||           
 Worm   560 AKSSSAVSSSNASSTPAPGSFAVQKAAPGTE-----DARTIFVSNLDFTTTEDEIRQAIEGVASI 619

  Fly   149 ----DGNS----RGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHV---VKFIPRRDREQEKATHF 202
                ..||    ||:.:|..::::.|:.|:.|        .:|.|   ..||...|  .||...|
 Worm   620 RFARKANSDLVHRGFAYVVMENDQKAQQALLK--------DRVPVKGRPMFISAND--PEKRVGF 674

  Fly   203 K--------NLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAA 259
            |        .::|:|:..:.|:..|:.:|..:|.:||.:.:..::|:.:...||.::...||...
 Worm   675 KFSTTLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKC 739

  Fly   260 VIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKA 301
            |..      ||...|        .||:.|:.......|:.|:
 Worm   740 VAS------GDKLML--------RERELEVALSNPPVKKDKS 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 14/88 (16%)
RRM3_I_PABPs 202..282 CDD:240826 19/87 (22%)
sart-3NP_502136.1 RRM_SF 681..761 CDD:418427 20/93 (22%)
Lsm_interact 818..835 CDD:398843
TPR 209..494 CDD:223533
RRM_SF 594..664 CDD:418427 15/77 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861654 Normalized mean entropy S4474
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.