Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380080.1 | Gene: | sqd-1 / 177392 | WormBaseID: | WBGene00022235 | Length: | 308 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 49/201 - (24%) |
---|---|---|---|
Similarity: | 93/201 - (46%) | Gaps: | 23/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 VGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRG 154
Fly 155 YGFVHFDSEEAARAAI----EKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFT 215
Fly 216 EQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARA 279
Fly 280 LSKAER 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 16/74 (22%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 22/80 (28%) | ||
sqd-1 | NP_001380080.1 | RRM2_NsCP33_like | 30..104 | CDD:410187 | 18/81 (22%) |
RRM_SF | 111..185 | CDD:418427 | 22/81 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |