DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and sqd-1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001380080.1 Gene:sqd-1 / 177392 WormBaseID:WBGene00022235 Length:308 Species:Caenorhabditis elegans


Alignment Length:201 Identity:49/201 - (24%)
Similarity:93/201 - (46%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRG 154
            :.|.|..:....|.....:.|. ||::..:...::|:.:...|:.:|.:....|..|. :|.|||
 Worm     8 INGNASETIKENGHSTKGNEDK-KIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRG 71

  Fly   155 YGFVHFDSEEAARAAI----EKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFT 215
            :.||.|.:.|..:.|:    :.:.|        ..|:..|.:.||.:|      ::|..|..:::
 Worm    72 FAFVEFTTGEGCKLALAAREQTIKG--------KSVEVKPAKSRENKK------VFVGGLPSDYS 122

  Fly   216 EQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARA 279
            ||.||..||.:|::...:...|::.::|| |.|:.:|..:||..|  ....||....:...|.:|
 Worm   123 EQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKA--SSQTKQTFGTRECDVKKA 185

  Fly   280 LSKAER 285
            :.:.:|
 Worm   186 VPQGKR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/74 (22%)
RRM3_I_PABPs 202..282 CDD:240826 22/80 (28%)
sqd-1NP_001380080.1 RRM2_NsCP33_like 30..104 CDD:410187 18/81 (22%)
RRM_SF 111..185 CDD:418427 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.