DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and sup-26

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001254892.1 Gene:sup-26 / 175551 WormBaseID:WBGene00006331 Length:476 Species:Caenorhabditis elegans


Alignment Length:357 Identity:77/357 - (21%)
Similarity:143/357 - (40%) Gaps:82/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PANYHQQQP---------ALNHHTLAAAHHQQQLHHHAAAAG----------HLSHVGGGHAASN 57
            |...:.|||         .|.|::.::..||...|:|::::.          |.|.....|..|.
 Worm     3 PTAQNSQQPYPRSDKAGGHLLHYSSSSHQHQNHQHYHSSSSNQQFNRPPPPPHNSQHHHHHNNSR 67

  Fly    58 HLAAAAVL---------------------GRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGST 101
            ..|::|..                     .:|.:......|....:|..      |.|..  |::
 Worm    68 MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRVQNHMR------GSGPF--GNS 124

  Fly   102 GGSGGNSSP------------DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSR 153
            .|.|..::|            .|..:||:.|..:.::..:.:..|.:|||.:.....|: ..|.:
 Worm   125 NGYGRYTAPRGDQQHHDSTPLSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCK 189

  Fly   154 GYGFVHFDSEEAARAAIEKVN--GMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTE 216
            |||||.|:|.:||.||::.:|  |:.....|:        :.:||:..    |||:.||..:|||
 Worm   190 GYGFVDFESPQAAAAAVDGLNTEGVQAQMAKL--------QQQEQDPT----NLYIANLPLDFTE 242

  Fly   217 QHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG----DNKFLYVA 277
            |.|......:|.:.|.:::...:.:||..||...::.:.....:..|:|.:..    :...|.:.
 Worm   243 QMLETELNKFGMVISTRILRTPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIK 307

  Fly   278 RALSKAERQQEINRKLEERKRQKAGQIF--YY 307
            :|.:..:.:..:|.. |..:|.:..|::  ||
 Worm   308 QADTGRKSKHSMNNP-EMLQRMQYPQVYQSYY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/72 (32%)
RRM3_I_PABPs 202..282 CDD:240826 20/83 (24%)
sup-26NP_001254892.1 RRM1_MSSP 148..218 CDD:240689 22/69 (32%)
RRM2_MSSP 229..310 CDD:240690 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.