DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and etr-1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001368521.1 Gene:etr-1 / 173401 WormBaseID:WBGene00001340 Length:589 Species:Caenorhabditis elegans


Alignment Length:169 Identity:48/169 - (28%)
Similarity:83/169 - (49%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SSPDSG--KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGN-SRGYGFVHF----DSEEA 165
            |.||:.  |:::..:.|..:.......|..:|::.:||:.:|:... |:|..||.|    |:.||
 Worm    48 SEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEA 112

  Fly   166 ARAA--IEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGR 228
            ..|.  |:.:.||      .|.|:..| .|.|....   :.|::..||::..|::|||:|..:|.
 Worm   113 QGALHNIKVIEGM------HHPVQMKP-ADTENRNE---RKLFIGQLSKKHNEENLREIFAKFGH 167

  Fly   229 ITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQ 267
            |....::.|::|:||...||.:.|...|:.|...:|..|
 Worm   168 IEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/76 (24%)
RRM3_I_PABPs 202..282 CDD:240826 21/66 (32%)
etr-1NP_001368521.1 RRM1_CELF1_2_Bruno 54..135 CDD:410040 22/87 (25%)
PABP-1234 57..>583 CDD:130689 44/160 (28%)
RRM2_Bruno_like 141..221 CDD:410044 21/69 (30%)
RRM3_CELF1-6 506..578 CDD:409797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.