DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and RBM46

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_659416.1 Gene:RBM46 / 166863 HGNCID:28401 Length:533 Species:Homo sapiens


Alignment Length:331 Identity:57/331 - (17%)
Similarity:107/331 - (32%) Gaps:122/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLE 121
            |..|..|::.:.|:|.                |...|.....|...|..|...|...::::..:.
Human    21 NEAALLALMEKTGYNM----------------VQENGQRKFGGPPPGWEGPPPPRGCEVFVGKIP 69

  Fly   122 RSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV 186
            |.:....:...|...|.|....:..:..|.:|||.||.:.::|.|:.||.     :.||.::...
Human    70 RDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIR-----ILNNYEIRPG 129

  Fly   187 KFI-------------------------------------------------------------- 189
            |||                                                              
Human   130 KFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDKTKNRGFAFVEYESH 194

  Fly   190 ----------------------------PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPY 226
                                        |.::.::|.....|.|||:||....||:.::..|..:
Human   195 RAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLYVRNLMISTTEETIKAEFNKF 259

  Fly   227 --GRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL-GDNKFLYVARALSKAER-QQ 287
              |.:...|.:.|       :.||.:.|.:.|:||:..::||.: |.:..:.:|:.::|... :|
Human   260 KPGAVERVKKLRD-------YAFVHFFNREDAVAAMSVMNGKCIDGASIEVTLAKPVNKENTWRQ 317

  Fly   288 EINRKL 293
            .:|.::
Human   318 HLNGQI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/69 (23%)
RRM3_I_PABPs 202..282 CDD:240826 22/82 (27%)
RBM46NP_659416.1 LSM_int_assoc 18..464 CDD:330438 57/331 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.