Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659416.1 | Gene: | RBM46 / 166863 | HGNCID: | 28401 | Length: | 533 | Species: | Homo sapiens |
Alignment Length: | 331 | Identity: | 57/331 - (17%) |
---|---|---|---|
Similarity: | 107/331 - (32%) | Gaps: | 122/331 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 NHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLE 121
Fly 122 RSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV 186
Fly 187 KFI-------------------------------------------------------------- 189
Fly 190 ----------------------------PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPY 226
Fly 227 --GRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL-GDNKFLYVARALSKAER-QQ 287
Fly 288 EINRKL 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 16/69 (23%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 22/82 (27%) | ||
RBM46 | NP_659416.1 | LSM_int_assoc | 18..464 | CDD:330438 | 57/331 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |