DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Elavl3

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_034617.1 Gene:Elavl3 / 15571 MGIID:109157 Length:367 Species:Mus musculus


Alignment Length:221 Identity:60/221 - (27%)
Similarity:100/221 - (45%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE- 148
            :.||.|..|.||.:|...|:.|.:......:.:..|.:::........|...|:|.:|.:.:|: 
Mouse    11 SQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKI 75

  Fly   149 DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEE 213
            .|.|.|||||::.....|..||..:||:....:.:.|     ...|....:....||||..|.:.
Mouse    76 TGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKV-----SYARPSSASIRDANLYVSGLPKT 135

  Fly   214 FTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVA 277
            .:::.:.::|..||||.:.:::||: .|.||..||:.::....|..|:.||:|:           
Mouse   136 MSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQ----------- 189

  Fly   278 RALSKAERQQEINRKLEERKRQKAGQ 303
            :.|..||   .|..|......||.||
Mouse   190 KPLGAAE---PITVKFANNPSQKTGQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/70 (26%)
RRM3_I_PABPs 202..282 CDD:240826 23/80 (29%)
Elavl3NP_034617.1 ELAV_HUD_SF 36..366 CDD:273741 51/196 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.