DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CSTF2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001293135.1 Gene:CSTF2 / 1478 HGNCID:2484 Length:597 Species:Homo sapiens


Alignment Length:114 Identity:33/114 - (28%)
Similarity:59/114 - (51%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENP 253
            |..||.      .::::|.|:..|.||:.|:::|...|.:.|.:|:.|.| |:.:.:||..|::.
Human     9 PAVDRS------LRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQ 67

  Fly   254 QSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
            ::||:|:..|:|::       :..|||.......|.|:  ||.|....|
Human    68 ETALSAMRNLNGRE-------FSGRALRVDNAASEKNK--EELKSLGTG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825
RRM3_I_PABPs 202..282 CDD:240826 24/80 (30%)
CSTF2NP_001293135.1 PABP-1234 4..352 CDD:130689 33/114 (29%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 24/80 (30%)
CSTF2_hinge 112..191 CDD:373015
PRK14718 <412..>469 CDD:173181
CSTF_C 553..593 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.