DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PABPC5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_543022.1 Gene:PABPC5 / 140886 HGNCID:13629 Length:382 Species:Homo sapiens


Alignment Length:207 Identity:91/207 - (43%)
Similarity:133/207 - (64%) Gaps:16/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEA 165
            |.||.       |.|:||||::||||:|::..||.|||||:|.|..|::| |:||.:|||||..|
Human    94 SQPDDRLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCDDNG-SKGYAYVHFDSLAA 157

  Fly   166 ARAAIEKVNGMLCNNQKVHVVKF-IPRRD----REQEKATHFKNLYVKNLSEEFTEQHLREMFEP 225
            |..||..:||:..||::|:|.:| .|...    |.:::|| |.|::|||:.::..::.|:|:|..
Human   158 ANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRAT-FTNVFVKNIGDDIDDEKLKELFCE 221

  Fly   226 YGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEIN 290
            ||...|.|::.|..|:|:.||||.||..::|..||:.||||.: |.|.|||.||..|.||..|:.
Human   222 YGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSI-DGKVLYVGRAQKKIERLAELR 285

  Fly   291 RKLEE-RKRQKA 301
            |:.|. |.::|:
Human   286 RRFERLRLKEKS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 38/69 (55%)
RRM3_I_PABPs 202..282 CDD:240826 35/79 (44%)
PABPC5NP_543022.1 PABP-1234 22..>379 CDD:130689 91/207 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52254
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.