DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and ZK616.61

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001255271.1 Gene:ZK616.61 / 13194041 WormBaseID:WBGene00194816 Length:340 Species:Caenorhabditis elegans


Alignment Length:85 Identity:18/85 - (21%)
Similarity:30/85 - (35%) Gaps:19/85 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSR 153
            ||....:|.|..|..|....|.:.|     ::.:.:.|:.|.            .||...:..|.
 Worm    97 VGAVRESLESWRTSSSSERPSAEEG-----SMTKKVSNEVVK------------RVAVKRELPSA 144

  Fly   154 GYGFVHFDSEEAA--RAAIE 171
            .|..|.:|....:  :|.:|
 Worm   145 EYHSVRYDERNLSLRKAQVE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 10/59 (17%)
RRM3_I_PABPs 202..282 CDD:240826
ZK616.61NP_001255271.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.